PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D02531.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 395aa    MW: 43260.9 Da    PI: 4.7727
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D02531.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.56.4e-27958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien+ nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs+++kl  +s
  Pahal.D02531.1  9 KRIENNVNRQVTFSKRRNGLIKKAYELSVLCDIDIALILFSPSDKLNHFS 58
                    79********************************************9997 PP

2K-box21.41e-08111179977
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                       +++ e+lq+e++k + +++ L++ +R +  + +   s++e +  e+ L + l+++ ++K+ ll++++
  Pahal.D02531.1 111 PVDSNIEELQHEIRKYQHQVQALEERLRMFEPDLVALASMNEVEATEKFLMETLTRVEERKKYLLCNHM 179
                     568999********************8888888888889**************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.002161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-28283IPR002100Transcription factor, MADS-box
CDDcd002654.81E-35275No hitNo description
PRINTSPR004043.3E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRVKLQIKR IENNVNRQVT FSKRRNGLIK KAYELSVLCD IDIALILFSP SDKLNHFSGR  60
RSIEDVITKY INLPEHDRGG IVRNREYLIK TLTQLKRESD IAEQLTPNKG PVDSNIEELQ  120
HEIRKYQHQV QALEERLRMF EPDLVALASM NEVEATEKFL METLTRVEER KKYLLCNHMG  180
PFDPSPADMQ QVFGLLPAPP QQHEQQGDMG VSAFGVGGDV VSWFADAMPG AGPSIFAGPD  240
PILAFRDQAI FDSLRRDAGV DPGMAAMCHV DQHGGGPSDD WQQAYTSAEL LSALIPSTPF  300
PLDDQVAARD DELDKTSTTA LQPRFSVHEL EAVIQDSMAP VLAPPMVPPP PHVHEQVEAS  360
AGSCSNVPPP GGDSAAAAAQ EQQHGLPDGA VNIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J6e-18278178Myocyte-specific enhancer factor 2A
3p57_I6e-18278178Myocyte-specific enhancer factor 2A
3p57_D6e-18278178Myocyte-specific enhancer factor 2A
3p57_C6e-18278178Myocyte-specific enhancer factor 2A
3p57_B6e-18278178Myocyte-specific enhancer factor 2A
3p57_A6e-18278178Myocyte-specific enhancer factor 2A
3kov_J6e-18278178Myocyte-specific enhancer factor 2A
3kov_I6e-18278178Myocyte-specific enhancer factor 2A
3kov_B6e-18278178Myocyte-specific enhancer factor 2A
3kov_A6e-18278178Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008647840.11e-169PREDICTED: MADS-box protein AGL66 isoform X1
TrEMBLA0A096T9Z31e-170A0A096T9Z3_MAIZE; Uncharacterized protein
STRINGGRMZM2G334225_P011e-169(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.16e-71AGAMOUS-like 66